1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-4
  6. FGF-4 Protein, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Background

FGF-4 Protein assumes a pivotal role in orchestrating embryonic development, cell proliferation, and cell differentiation. Its indispensability is evident in the normal development of limbs and cardiac valves during embryogenesis. Additionally, FGF-4 may contribute to embryonic molar tooth bud development by inducing the expression of key genes, including MSX1, MSX2, and SDC1, in dental mesenchyme cells, thus highlighting its diverse regulatory functions. FGF-4 engages in intricate interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular alliances critical for signaling cascades. The binding affinity between FGF-4 and its receptors is potentiated by heparan sulfate glycosaminoglycans, serving as indispensable coreceptors in this complex regulatory network. These interactions underscore the multifaceted and essential role of FGF-4 in driving fundamental processes during development.

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 cells. The ED50 this effect is 0.1245 ng/mL, corresponding to a specific activity is 8.03×106 units/mg.

  • Measured in a cell proliferation assay using NIH-3T3 cells. The ED50 this effect is 0.1245 ng/mL, corresponding to a specific activity is 8.03×106 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P08620-1 (S71-L206)

Gene ID
Molecular Construction
N-term
FGF-4 (S71-L206)
Accession # P08620-1
C-term
Protein Length

Partial

Synonyms
FGF4; Fibroblast growth factor 4; FGF-4; Transforming protein KS3; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; HST; HSTF1; KS3
AA Sequence

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Predicted Molecular Mass
15.1 kDa
Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 5% Trehalose, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

< 0.1 ng/µg (1 EU/µg) as determined by LAL test.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-4 Protein, Human (136a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-4 Protein, Human (136a.a)
Cat. No.:
HY-P700288
Quantity:
MCE Japan Authorized Agent: