1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-23
  6. FGF-23 Protein, Mouse (HEK293, His)

FGF-23 protein is a key regulator that maintains phosphate homeostasis by inhibiting tubular phosphate transport and reducing SLC34A1 levels. It directly inhibits PTH secretion, regulates vitamin D metabolism, and negatively affects osteoblast differentiation and matrix mineralization. FGF-23 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-23 protein, expressed by HEK293 , with C-6*His labeled tag and R179Q mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-23 protein is a key regulator that maintains phosphate homeostasis by inhibiting tubular phosphate transport and reducing SLC34A1 levels. It directly inhibits PTH secretion, regulates vitamin D metabolism, and negatively affects osteoblast differentiation and matrix mineralization. FGF-23 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-23 protein, expressed by HEK293 , with C-6*His labeled tag and R179Q mutation.

Background

FGF-23 protein serves as a key regulator in maintaining phosphate homeostasis by inhibiting renal tubular phosphate transport, primarily through the reduction of SLC34A1 levels. Additionally, it acts directly on the parathyroid to suppress PTH secretion and plays a pivotal role in vitamin-D metabolism regulation. FGF-23 serves as a negative regulator of osteoblast differentiation and matrix mineralization. Furthermore, it exhibits the ability to up-regulate EGR1 expression in the presence of KL and interacts with various fibroblast growth factor receptors (FGFRs), including FGFR1, FGFR2, FGFR3, and FGFR4. The interaction between FGF-23 and FGFRs is facilitated by KL and heparan sulfate glycosaminoglycans, acting as coreceptors.

Biological Activity

Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The ED50 for this effect is 0.2468 μg/mL in the presence of 1 μg/mL murine Klotho and 100μg/mL heparin, corresponding to a specific activity is 4.051×103units/mg.

  • Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The ED50 for this effect is 0.2468 μg/mL in the presence of 1 μg/mL murine Klotho and 100μg/mL heparin, corresponding to a specific activity is 4.051×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9EPC2 (Y25-V251, R179Q)

Gene ID

64654

Molecular Construction
N-term
FGF-23 (Y25-V251, R179Q)
Accession # Q9EPC2
6*His
C-term
Synonyms
ADHR; FGF23; FGF-23; fibroblast growth factor 23; HPDR2; HYPF; phosphatonin; PHPTC; tumor-derived hypophosphatemia inducing factor; Tumor-derived hypophosphatemia-inducing factor
AA Sequence

YPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTQSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV

Molecular Weight

Approximately 30-32 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS, 150 mM NaCl, pH 7.4, 1 mM EDTA, 1 mM DTT, 8% trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-23 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-23 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P702509
Quantity:
MCE Japan Authorized Agent: