1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-23
  6. FGF-23 Protein, Human

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

FGF-23 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE FGF-23 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

Background

Recombinant Human Fibroblast Growth Factor 23 is a unique FGF subfamily member, acts as a a hormone and requires a cofactor to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis[1]. FGF23 is a secreted, circulating protein of 32 kDa that is predominantly produced by osteocytesin bone and functions in distant target organs in an endocrine fashion. FGF23 generally requires an FGF receptor (FGFR) and α-Klotho to evoke its signaling. GF23 binds to an FGFR-α-Klotho complex and induces the phosphorylation of FGFR and the expression of early growth response-1 (Egr-1), which encodes a transcription factor[2].

Biological Activity

The ED50 is <0.5 μg/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of >2.0 × 103 units/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9GZV9 (Y25-F251)

Gene ID
Molecular Construction
N-term
FGF-23 (Y25-F251)
Accession # Q9GZV9
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuFGF-23; Phosphatonin; Tumor-derived hypophosphatemia-inducing factor
AA Sequence

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Molecular Weight

Approximately 25.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FGF-23 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-23 Protein, Human
Cat. No.:
HY-P7013
Quantity:
MCE Japan Authorized Agent: