1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-15
  6. FGF-15 Protein, Mouse (His-SUMO)

FGF-15 Protein crucially suppresses bile acid biosynthesis by down-regulating CYP7A1 expression, contributing to intricate bile acid homeostasis control. Interacting with MALRD1 suggests potential involvement in molecular pathways beyond bile acid regulation. The molecular associations and regulatory functions underscore FGF-15's significance in maintaining physiological balance, particularly in bile acid metabolism. FGF-15 Protein, Mouse (His-SUMO) is the recombinant mouse-derived FGF-15 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-15 Protein crucially suppresses bile acid biosynthesis by down-regulating CYP7A1 expression, contributing to intricate bile acid homeostasis control. Interacting with MALRD1 suggests potential involvement in molecular pathways beyond bile acid regulation. The molecular associations and regulatory functions underscore FGF-15's significance in maintaining physiological balance, particularly in bile acid metabolism. FGF-15 Protein, Mouse (His-SUMO) is the recombinant mouse-derived FGF-15 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

The FGF-15 Protein plays a crucial role in the suppression of bile acid biosynthesis by down-regulating CYP7A1 expression. Through its regulatory activity, FGF-15 contributes to the intricate control of bile acid homeostasis. Additionally, the protein interacts with MALRD1, suggesting potential involvement in molecular pathways and processes beyond bile acid regulation. The molecular associations and regulatory functions of FGF-15 highlight its significance in maintaining physiological balance, particularly in the context of bile acid metabolism.

Species

Mouse

Source

E. coli

Tag

N-His;N-SUMO

Accession

O35622 (R26-K218)

Gene ID
Molecular Construction
N-term
6*His-SUMO
FGF-15 (R26-K218)
Accession # O35622
C-term
Protein Length

Full Length of Mature Protein

Synonyms
FGF-15; Fgf15; FGF15_MOUSE; FGF19; Fibroblast growth factor 15
AA Sequence

RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK

Molecular Weight

Approximately 38 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-15 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-15 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P71526
Quantity:
MCE Japan Authorized Agent: