1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-12
  6. FGF-12 Protein, Human

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. FGF-12 Protein, Human is the recombinant human-derived FGF-12 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. FGF-12 Protein, Human is the recombinant human-derived FGF-12 protein, expressed by E. coli , with tag free.

Background

FGF-12, a pivotal player in nervous system development and function, exerts its influence by positively regulating the activity of voltage-gated sodium channels. Specifically, FGF-12 contributes to the enhancement of neuronal excitability by modulating the voltage dependence of SCN8A fast inactivation, thereby influencing the dynamics of sodium channel behavior. This intricate regulatory role underscores FGF-12's significance in shaping neuronal activity and highlights its interaction with the C-terminal region of SCN9A, emphasizing its involvement in the intricate molecular interplay associated with voltage-gated sodium channel function.

Biological Activity

Immobilized FGFR4 at 2 μg/mL (100 μL/well) can bind Biotinylated FGF-12. The ED50 for this effect is 0.3899 µg/mL.

  • Immobilized FGFR4 at 2 μg/mL (100 μL/well) can bind Biotinylated FGF-12. The ED50 for this effect is 0.3899 µg/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P61328-2 (M1-T181)

Gene ID
Molecular Construction
N-term
FGF-12 (M1-T181)
Accession # P61328-2
C-term
Synonyms
Fibroblast growth factor 12; FGF-12; FHF-1; FGF12B
AA Sequence

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Weight

18-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 5 mM EDTA, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-12 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-12 Protein, Human
Cat. No.:
HY-P72654
Quantity:
MCE Japan Authorized Agent: