2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. FGF Family
  5. Fibroblast Growth Factor
  6. FGF-1
  7. FGF-1 Protein, Rat

FGF-1 Protein, Rat is the recombinant rat-derived FGF-1 protein, expressed by E. coli, with tag free tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-1 Protein, Rat is the recombinant rat-derived FGF-1 protein, expressed by E. coli, with tag free tag.
Background

The FGF-1 protein plays a pivotal role in regulating important cellular processes such as cell survival, division, angiogenesis, differentiation, and migration. In vitro, it exhibits potent mitogenic properties and acts as a ligand for both FGFR1 and integrins. When heparin is present, FGF-1 binds to FGFR1, resulting in the dimerization and activation of FGFR1 through autophosphorylation on tyrosine residues. These phosphorylated residues serve as docking sites for interacting proteins, initiating various signaling cascades. FGF-1 also binds to integrins and forms a ternary complex with integrins and FGFR1, which is crucial for FGF-1 signaling.
Species

Rat
Source

E. coli
Tag

Tag Free
Accession

P61149 (M1-D155)
Gene ID

25317
Molecular Construction
N-term
FGF-1 (M1-D155)
Accession # P61149
C-term
Synonyms
Fibroblast growth factor 1; HBGF-1;  FGF1;  FGF-a;  FGF-acidic
AA Sequence

MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Predicted Molecular Mass
15.9 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE. Greater than 95% as determined by SEC-HPLC.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

FGF-1 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-1 Protein, Rat
Cat. No.:
HY-P704537
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.