1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-1
  6. FGF-1 Protein, Mouse (N-His)

The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived FGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived FGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The FGF-1 protein plays a crucial role in the regulation of various cellular processes, including cell survival, division, angiogenesis, differentiation, and migration. It acts as a potent mitogen and functions as a ligand for both FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, leading to dimerization and activation through autophosphorylation on tyrosine residues, which serve as docking sites for interacting proteins. This activation triggers multiple signaling cascades. FGF-1 also binds to integrin ITGAV:ITGB3, forming a ternary complex with FGFR1 and inducing the recruitment of PTPN11 to the complex, which is essential for FGF-1 signaling. It induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and can also stimulate angiogenesis. FGF-1 interacts with several receptors and proteins, including FGFR2, FGFR3, FGFR4, FGFBP1, S100A13, SYT1, LRRC59, CSNKA, CSNKB, and FIBP. Additionally, it forms a Cu(2+)-dependent multiprotein aggregate with S100A13 and SYT1. While the interaction of FGF-1 with LRRC59, CSNKA, and FIBP appears to be mutually exclusive, CSNKB and FIBP may cooperatively interact with FGF-1. Overall, FGF-1 plays a complex role in cellular processes through its interactions with various receptors and proteins.

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells.The ED50 for this effect is ≤0.4015 ng/mL, corresponding to a specific activity is ≥2.490×106 units/mg.

  • Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells.The ED50 for this effect is 0.4015 ng/mL, corresponding to a specific activity is 2.490×106 units/mg.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P61148 (F16-D155)

Gene ID
Protein Length

Full Length of Mature Protein

Synonyms
rMuaFGF; HBGF-1; FGF1; FGF-a; FGF-acidic
AA Sequence

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Predicted Molecular Mass
15.8 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 6.5 or 50 mM Tris-HCl, 300 mM NaCl, pH 6.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-1 Protein, Mouse (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-1 Protein, Mouse (N-His)
Cat. No.:
HY-P700282
Quantity:
MCE Japan Authorized Agent: