1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. B Cell CD Proteins Fc Receptor-like Proteins
  4. CD307a/FCRL1 Fc Receptor Like 1 (FCRL1)
  5. FCRL1 Protein, Human (HEK293, His)

The FCRL1 protein may act as an activation coreceptor in B cells, suggesting involvement in B cell activation and differentiation processes. The dual role of FCRL1 makes it a key player in regulating B cell responses and enhancing signaling pathways associated with B cell activation. FCRL1 Protein, Human (HEK293, His) is the recombinant human-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FCRL1 protein may act as an activation coreceptor in B cells, suggesting involvement in B cell activation and differentiation processes. The dual role of FCRL1 makes it a key player in regulating B cell responses and enhancing signaling pathways associated with B cell activation. FCRL1 Protein, Human (HEK293, His) is the recombinant human-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The FCRL1 Protein takes on a potential role as an activating coreceptor in B-cells, suggesting its involvement in the intricate processes of B-cell activation and differentiation. This dual functionality positions FCRL1 as a key player in the modulation of B-cell responses, where it may act as a coreceptor to enhance signaling pathways associated with B-cell activation. The broader implication of FCRL1 in B-cell differentiation underscores its significance in orchestrating the nuanced cellular events that contribute to the adaptive immune response.

Biological Activity

Immobilized FCRL1 at 2 μg/mL (100 μL/well) can bind biotinylated Human IgG. The KD for this effect is 38.39 nM.

  • Immobilized FCRL1 at 2 μg/mL (100 μL/well) can bind biotinylated Human IgG. The KD for this effect is 38.39 nM.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q96LA6-1 (A17-N303)

Gene ID
Molecular Construction
N-term
FCRL1 (A17-N303)
Accession # Q96LA6-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Fc receptor-like protein 1; FcRL1; FcRH1; hIFGP1; CD307a; FCRH1; IFGP1; IRTA5
AA Sequence

AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSN

Molecular Weight

39-50 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 1 mM EDTA.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FCRL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P72655
Quantity:
MCE Japan Authorized Agent: