1. Recombinant Proteins
  2. Fc Receptors
  3. FcRn
  4. FCGRT Protein, Human (GST)

The FCGRT protein is a cell surface receptor that conveys passive humoral immunity through the selective uptake of monomeric IgG in milk. It binds IgG at the intestinal epithelium and forms an FcRn-IgG complex that is transcytosed across the epithelium, releasing IgG into the blood or tissue. FCGRT Protein, Human (GST) is the recombinant human-derived FCGRT protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FCGRT protein is a cell surface receptor that conveys passive humoral immunity through the selective uptake of monomeric IgG in milk. It binds IgG at the intestinal epithelium and forms an FcRn-IgG complex that is transcytosed across the epithelium, releasing IgG into the blood or tissue. FCGRT Protein, Human (GST) is the recombinant human-derived FCGRT protein, expressed by E. coli , with N-GST labeled tag.

Background

FCGRT, a crucial cell surface receptor, facilitates the transfer of passive humoral immunity from the mother to the newborn by binding to the Fc region of monomeric immunoglobulin gamma and selectively mediating its uptake from milk. The process involves IgG binding at the apical surface of the intestinal epithelium, forming FcRn-IgG complexes that transcytose across the intestinal epithelium, releasing IgG into blood or tissue fluids. Beyond infancy, FCGRT plays a pivotal role in effective humoral immunity by recycling IgG and prolonging its half-life in the circulation. Mechanistically, the binding of monomeric IgG to FCGRT in acidic endosomes of endothelial and hematopoietic cells facilitates the recycling of IgG to the cell surface, subsequently releasing it into circulation. Additionally, FCGRT regulates the homeostasis of albumin/ALB, the other most abundant circulating protein, further underscoring its essential role in immune and protein homeostasis. In the context of microbial infection, FCGRT acts as an uncoating receptor for various echoviruses, including Echovirus 5, 6, 7, 9, 11, 13, 25, and 29.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P55899 (A24-S297)

Gene ID
Molecular Construction
N-term
GST
FCGRT (A24-S297)
Accession # P55899
C-term
Protein Length

Extracellular Domain

Synonyms
Alpha chain; Fc fragment of IgG; receptor transporter; alpha; FCGRN_HUMAN; FCGRT; FcRn alpha chain; FcRn; FCRN; alpha chain; IgG Fc fragment receptor transporter alpha chain; IgG Gc receptor; IgG receptor FcRn large subunit p51; IgG receptor FcRn large subunit p51 precursor; Immunoglobulin receptor; intestinal; heavy chain; Neonatal Fc receptor
AA Sequence

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Molecular Weight

Approximately 57.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

FCGRT Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FCGRT Protein, Human (GST)
Cat. No.:
HY-P72192
Quantity:
MCE Japan Authorized Agent: