1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. CD300a
  5. Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His)

Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His)

Cat. No.: HY-P75621A
Handling Instructions Technical Support

Fc γ RIIIA/CD16a is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG). Fc γ RIIIA/CD16a regulates NK cell survival and proliferation and prevents NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the anti-tumor activity of therapeutic antibodies by triggering TNFA-dependent ADCC, which promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication through antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His) is the recombinant rat-derived Fc gamma RIIIA/CD16a, expressed by HEK293, with C-His labeled tag. The total length of Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His) is 179 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Fc γ RIIIA/CD16a is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG). Fc γ RIIIA/CD16a regulates NK cell survival and proliferation and prevents NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the anti-tumor activity of therapeutic antibodies by triggering TNFA-dependent ADCC, which promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication through antibody-dependent enhancement (ADE). Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His) is the recombinant rat-derived Fc gamma RIIIA/CD16a, expressed by HEK293, with C-His labeled tag. The total length of Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His) is 179 a.a..

Background

The Fc γ RIIIA/CD16a protein is a receptor for the invariant Fc fragment of immunoglobulin γ (IgG) and is optimally activated upon binding to the aggregation antigen-igg complex displayed on the cell surface, initiating antibody-dependent cytotoxicity (ADCC). Fc γ RIIIA/CD16a mediates IgG effects on natural killer (NK) cells, binding to antigen-igg complexes produced during infection, triggering NK cell-dependent cytokine production and degranulation. Fc γ RIIIA/CD16a plays a crucial role in the generation of memory-like adaptive NK cells, regulating NK cell survival and proliferation, and preventing NK cell progenitor cell apoptosis. Fc γ RIIIA/CD16a plays a role in mediating the antitumor activity of therapeutic antibodies, triggering TNFA-dependent ADCC in IgG-coated tumor cells and enhancing ADCC in response to focused IgG. Fc γ RIIIA/CD16a is involved in pathogenesis through an antibody-dependent enhancement (ADE) mechanism that promotes the entry of the virus into bone marrow cells during secondary infection and subsequent viral replication[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat CD16a protein at 10 μg/mL (100 μL/well) can bind Human IgG1. The ED50 for this effect is 93.49 ng/mL.

Species

Rat

Source

HEK293

Tag

C-His

Accession

XP_008767961.1 (L22-P200)

Gene ID

304966

Protein Length

Partial

Synonyms
Low affinity immunoglobulin gamma Fc region receptor III-A; FcRIIIa; FcR-10; CD16a; FCGR3A; IGFR3
AA Sequence

LQKAVVILDPEWVRVLEEDCVILRCQGTFSPEDNSTKWFHNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEGDPIRLRCHSWRNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNISSASLQISIGDPTSPSSFLP

Molecular Weight

Approximately 27-32 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIIA/CD16a Protein, Rat (HEK293, C-His)
Cat. No.:
HY-P75621A
Quantity:
MCE Japan Authorized Agent: