1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Fc Receptors
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. FcγRIIIA/CD16a CD300a Fc gamma RIII/CD16
  5. Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, SUMO-His)

Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, SUMO-His)

Cat. No.: HY-P78676
Handling Instructions Technical Support

Fc gamma RIIIA/CD16a protein is a receptor for the Fc fragment of IgG and activates antibody-dependent cellular cytotoxicity (ADCC) upon binding to antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, SUMO-His) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-His, N-SUMO labeled tag and F176V mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIIA/CD16a protein is a receptor for the Fc fragment of IgG and activates antibody-dependent cellular cytotoxicity (ADCC) upon binding to antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, SUMO-His) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-His, N-SUMO labeled tag and F176V mutation.

Background

Fc gamma RIIIA/CD16a Protein serves as a receptor for the invariable Fc fragment of immunoglobulin gamma (IgG), optimally activated upon binding clustered antigen-IgG complexes displayed on cell surfaces, initiating antibody-dependent cellular cytotoxicity (ADCC). This process involves the lysis of antibody-coated cells, preventing inappropriate effector cell activation in the absence of an antigenic trigger. The protein mediates IgG effector functions on natural killer (NK) cells, binding antigen-IgG complexes generated during infection to trigger NK cell-dependent cytokine production and degranulation. Fc gamma RIIIA/CD16a is crucial in generating memory-like adaptive NK cells that efficiently eliminate virus-infected cells via ADCC. It regulates NK cell survival, proliferation, and prevents NK cell progenitor apoptosis. As an Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, leading to intracellular signaling cascades that drive NK cell activation. The protein also plays a role in mediating the antitumor activities of therapeutic antibodies, triggering TNFA-dependent ADCC of IgG-coated tumor cells and enhancing ADCC in response to afucosylated IgGs. In the context of Dengue virus infection, Fc gamma RIIIA/CD16a is involved in pathogenesis through an antibody-dependent enhancement (ADE) mechanism, facilitating virus entry into myeloid cells and subsequent viral replication during secondary infections.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human FcγRIIIA / CD16a recombinant protein at 2 μg/mL(100 μL/well) can bind Human IgG1. The ED50 for this effect is 93.49 ng/mL, corresponding to a specificactivity is 1.070×10^4 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Human FcγRIIIA / CD16a recombinant protein at 2μg/mL(100 μL/well) can bind Human IgG1.The ED50 for this effect is 93.49 ng/mL, corresponding to a specificactivity is 1.070×104 Unit/mg.
Species

Human

Source

HEK293

Tag

C-His;N-SUMO

Accession

P08637 (G17-Q208, F176V)

Gene ID
Molecular Construction
N-term
SUMO
CD16a (G17-Q208, F176V)
Accession # P08637
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
FCGR3A; CD16A; FCG3; FCGR3; IGFR3
AA Sequence

GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Molecular Weight

42-65 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, SUMO-His)
Cat. No.:
HY-P78676
Quantity:
MCE Japan Authorized Agent: