Fc gamma RIIIA/CD16a Protein, Cynomolgus (HEK293, His)

FCGR3A is a receptor for the Fc portion of immunoglobulin G that enhances antibody-dependent cell-mediated cytotoxicity and antibody-dependent viral infection. FCGR3A is also a potential immune oncogenic molecule and is related to the level of tumor immune infiltration. FCGR3A is often used as a biomarker with prognostic value in prostate cancer (PCa). Fc gamma RIIIA/CD16a Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-6*His labeled tag.

FCGR3A is a receptor for the Fc portion of immunoglobulin G, an integral membrane glycoprotein expressed on natural killer (NK) cells anchored by a transmembrane peptide. Whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMNs), where the receptor is anchored via a phosphatidylinositol (PI) linkage. FCGR3A enhances antibody-dependent cell-mediated cytotoxicity and antibody-dependent viral infection. Differential analysis results of public databases show that FCGR3A is generally highly expressed in pan-cancers, and its expression has been confirmed to be related to the infiltration of multiple immune cells, the expression of multiple immune checkpoint genes and DNA mismatch repair genes in systemic cancers. There is a negative correlation between FCGR3A and DNA methylation levels. FCGR3A and HAVCR2 are highly expressed in PCa and are associated with BCR-free survival in PCa patients. Therefore, FCGR3A is a biomarker with potential prognostic value in prostate cancer (PCa). FCGR3A may also be an immuno-oncogenic molecule that correlates with the level of tumor immune infiltration and affects drug sensitivity. In addition, studies have found that FCGR3A gene duplications are associated with HIV-1 acquisition and that allelic variants in FCGR3A play a role in HIV-1 infection in infants and control susceptibility to HIV-1 infection.

Cynomolgus

HEK293

C-6*His

A0A140HDP8 (E21-G206)

102140945  [NCBI]

Extracellular Domain

EDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPG

Approximately 30-40 kDa,based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.