1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. FcγRIIIA/CD16a Fc gamma RIII/CD16
  5. Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His)

Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P77663
Handling Instructions Technical Support

The FcγRIIIA/CD16a protein is a receptor for IgG and is optimally activated upon binding of aggregated antigen-IgG complexes, inducing antibody-dependent cellular cytotoxicity (ADCC). It mediates IgG effector function on natural killer cells, limiting viral load. Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FcγRIIIA/CD16a protein is a receptor for IgG and is optimally activated upon binding of aggregated antigen-IgG complexes, inducing antibody-dependent cellular cytotoxicity (ADCC). It mediates IgG effector function on natural killer cells, limiting viral load. Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-His labeled tag.

Background

The FcγRIIIA/CD16a Protein functions as a receptor for the constant Fc fragment of immunoglobulin gamma (IgG), optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, leading to antibody-dependent cellular cytotoxicity (ADCC). It mediates IgG effector functions on natural killer (NK) cells, triggering cytokine production, degranulation, and limiting viral load during infection. Additionally, FcγRIIIA is involved in the generation of memory-like adaptive NK cells that efficiently eliminate virus-infected cells via ADCC and regulate NK cell survival and proliferation. As a Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, initiating intracellular signaling pathways such as phosphatidylinositol 3-kinase signaling and calcium flux, crucial for NK cell activation. FcγRIIIA also costimulates NK cells, triggering lysis of target cells independently of IgG binding. It plays a role in mediating the antitumor activities of therapeutic antibodies and, upon ligation on monocytes, induces tumor necrosis factor-alpha (TNFA)-dependent ADCC of IgG-coated tumor cells. Furthermore, FcγRIIIA interacts with CD2, contributing to NK cell activation and cytotoxicity, and interacts with S100A4, inhibiting PKC-dependent phosphorylation of FCGR3A.

Biological Activity

1. Measured by its binding ability in a SPR assay (Biacore T200). Rituximab captured on CM5 Chip via Protein A can bind Cynomolgus Fc gamma RIII with an affinity constant of 0.251 μM.
2. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED50 for this effect is 0.276 μg/mL, corresponding to a specific activity is 3.62×10^3 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED50 for this effect is 0.276 μg/mL, corresponding to a specific activity is 3.62×103 Unit/mg.
Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

Q8SPW2 (G17-Q208)

Gene ID
Molecular Construction
N-term
CD16 (G17-Q208)
Accession # Q8SPW2
His
C-term
Protein Length

Extracellular Domain

Synonyms
IgG Fc receptor III; Fc-gamma RIII; FcRIII; FCGR3; CD16; CD16A; FCG3; FcgRIII; FCR-10; FCRIIIA; IGFR3; IMD20
AA Sequence

GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ

Molecular Weight

33-40 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77663
Quantity:
MCE Japan Authorized Agent: