1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32 FCGR2A/CD32a
  5. FCGR2A/CD32a
  6. Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His)

Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P75647
Handling Instructions Technical Support

The Fc γ RIIA/CD32a protein plays a key role by specifically binding to the Fc region of immunoglobulin γ, acting as a low-affinity receptor. Fc γ RIIA/CD32a initiates cellular responses against pathogens and soluble antigens and plays an important role in immune regulation. Fc γ RIIA/CD32a interacts with PI3K and Syk. Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Fc γ RIIA/CD32a protein plays a key role by specifically binding to the Fc region of immunoglobulin γ, acting as a low-affinity receptor. Fc γ RIIA/CD32a initiates cellular responses against pathogens and soluble antigens and plays an important role in immune regulation. Fc γ RIIA/CD32a interacts with PI3K and Syk. Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-His labeled tag.

Background

The Fc γ RIIA/CD32a protein plays a key role by specifically binding to the Fc region of immunoglobulin γ, acting as a low-affinity receptor. By interacting with IgG, Fc γ RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, playing an important role in immune regulation. The Fc γ RIIA/CD32a protein promotes the phagocytosis of  sporophoric antigens, further promoting the immune defense mechanism. In addition, Fc γ RIIA/CD32a interacts with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK to participate in complex signaling pathways and regulate their cellular functions. Fc γ RIIA/CD32a interacts with PI3K and Syk[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rhesus Macaque CD32a protein at 5 μg/mL (100 μL/well) can bind Human IgG1. The ED50 for this effect is 0.8076 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rhesus Macaque CD32a protein at 5μg/mL(100μL/well) can bind Human IgG1. The ED50 for this effect is 0.8076 μg/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

H9BMP0 (Q34-I217)

Gene ID
Molecular Construction
N-term
CD32a (Q34-I217)
Accession # H9BMP0
His
C-term
Protein Length

Partial

Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-a; CD32; FCGR2A; FCG2; IGFR2
AA Sequence

QTAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYMFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTTHLEFREGETIMLRCHSWKDKPLIKVAFFQNGKSKNFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSVGSSSPMGI

Molecular Weight

Approximately 25-35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE. It migrates as an approximately 25-35 kDa band in SDS-PAGE under reducing conditions.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P75647
Quantity:
MCE Japan Authorized Agent: