FBXO48 Protein, Human (His, Myc)

The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

F-box only protein 48 is part of the SCF ubiquitin ligase complex and is involved in the catabolic process of SCF-dependent proteasome ubiquitin-dependent proteins. FBXO48 performs polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampkα (PAMPK-α). FBXO48 gene is located at the pathogenic gene locus 2p13.3 of Parkinson's disease type 3 (PARK3) and is one of the homologous genes of the pathogenic gene F-box only protein 7 gene (FBXO7) of Parkinson's disease type 15 (PARK15). Also known as Parkinsonian pyramidopathy (PPD)^[1][2][3].

Human

E. coli

N-His;C-Myc

Q5FWF7 (M1-R155)

554251  [NCBI]

Full Length

MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.