1. Recombinant Proteins
  2. Others
  3. FBXO48 Protein, Human (His, Myc)

The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

F-box only protein 48 is part of the SCF ubiquitin ligase complex and is involved in the catabolic process of SCF-dependent proteasome ubiquitin-dependent proteins. FBXO48 performs polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampkα (PAMPK-α). FBXO48 gene is located at the pathogenic gene locus 2p13.3 of Parkinson's disease type 3 (PARK3) and is one of the homologous genes of the pathogenic gene F-box only protein 7 gene (FBXO7) of Parkinson's disease type 15 (PARK15). Also known as Parkinsonian pyramidopathy (PPD)[1][2][3].

Species

Human

Source

E. coli

Tag

N-His;C-Myc

Accession

Q5FWF7 (M1-R155)

Gene ID

554251  [NCBI]

Molecular Construction
N-term
10*His
FBXO48 (M1-R155)
Accession # Q5FWF7
Myc
C-term
Protein Length

Full Length

Synonyms
FBXO48; FBX48F-box only protein 48
AA Sequence

MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER

Predicted Molecular Mass
25.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FBXO48 Protein, Human (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FBXO48 Protein, Human (His, Myc)
Cat. No.:
HY-P71558
Quantity:
MCE Japan Authorized Agent: