1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin/UBLs
  4. Ubiquitin-Like Protein FUBI
  5. FAU Protein, Human (GST)

FAU proteins are involved in potential proapoptotic activities, suggesting involvement in programmed cell death pathways. It functions in the 40S ribosomal subunit and is essential for assembly and function. FAU Protein, Human (GST) is the recombinant human-derived FAU protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FAU proteins are involved in potential proapoptotic activities, suggesting involvement in programmed cell death pathways. It functions in the 40S ribosomal subunit and is essential for assembly and function. FAU Protein, Human (GST) is the recombinant human-derived FAU protein, expressed by E. coli , with N-GST labeled tag.

Background

The FAU protein is implicated in potential pro-apoptotic activities, suggesting its involvement in programmed cell death pathways. Additionally, it functions as a component of the 40S subunit of the ribosome, playing a crucial role in the assembly and function of these subunits. The dual nature of FAU, both in apoptotic regulation and its contribution to ribosomal subunit assembly, underscores its multifaceted role within cellular processes, spanning from programmed cell death mechanisms to fundamental aspects of protein synthesis. The precise mechanisms underlying FAU's pro-apoptotic activity and its impact on ribosomal function remain areas of interest in understanding its broader cellular functions.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P62861/NM_001997 (M1-S133)

Gene ID
Molecular Construction
N-term
GST
FAU (M1-S133)
Accession # P62861/NM_001997
C-term
Protein Length

Full Length

Synonyms
FAU; Ubiquitin-like protein FUBI
AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Molecular Weight

Approximately 44 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FAU Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FAU Protein, Human (GST)
Cat. No.:
HY-P71681
Quantity:
MCE Japan Authorized Agent: