1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily T Cell CD Proteins NK Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Superfamily Ligands FasL/CD178 FasL/CD178
  5. FasL/CD178
  6. Fas Ligand Protein, Human (His)

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals.Fas Ligand Protein, Human (His) is the recombinant human-derived FASLG protein, expressed by E. coli , with N-6*His labeled tag.

Background

FASLG protein, a cytokine, specifically binds to TNFRSF6/FAS, serving as a crucial mediator of apoptotic signals within cells. It plays integral roles in various cellular processes, including cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis, and T-cell development. FASLG is actively involved in initiating fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells, contributing to the controlled termination of immune responses. Additionally, TNFRSF6/FAS-mediated apoptosis, facilitated by FASLG, plays a role in the induction of peripheral tolerance. Notably, FASLG binds to TNFRSF6B/DcR3, a decoy receptor that functions to block apoptosis. Furthermore, FASLG has the capacity to induce FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways, and, while it can induce apoptosis, its essentiality for this process remains to be confirmed.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P48023-1 (Q103-L281)

Gene ID

356  [NCBI]

Molecular Construction
N-term
6*His
Fas Ligand (Q103-L281)
Accession # P48023-1
C-term
Protein Length

Extracellular Domain

Synonyms
Apoptosis antigen ligand ; APTLCD95 ligand ; CD95-LFas antigen ligand ; Fas ligand ; FasL; CD178
AA Sequence

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Molecular Weight

26 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fas Ligand Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fas Ligand Protein, Human (His)
Cat. No.:
HY-P700520
Quantity:
MCE Japan Authorized Agent: