1. Recombinant Proteins
  2. Others
  3. ETS1/EWSR2 Protein, Human (His)

ETS1/EWSR2 Protein, a transcription factor, directly regulates cytokine and chemokine gene expression in diverse cellular contexts. It controls lymphoid cell differentiation, survival, and proliferation, possibly impacting angiogenesis by regulating genes controlling endothelial cell migration and invasion. Additionally, it acts as a dominant-negative for isoform c-ETS-1A. ETS1/EWSR2 Protein, Human (His) is the recombinant human-derived ETS1/EWSR2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE ETS1/EWSR2 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ETS1/EWSR2 Protein, a transcription factor, directly regulates cytokine and chemokine gene expression in diverse cellular contexts. It controls lymphoid cell differentiation, survival, and proliferation, possibly impacting angiogenesis by regulating genes controlling endothelial cell migration and invasion. Additionally, it acts as a dominant-negative for isoform c-ETS-1A. ETS1/EWSR2 Protein, Human (His) is the recombinant human-derived ETS1/EWSR2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ETS1/EWSR2 protein, a transcription factor, exerts direct control over the expression of cytokine and chemokine genes across diverse cellular contexts. Its regulatory influence extends to the differentiation, survival, and proliferation of lymphoid cells, emphasizing its pivotal role in immune-related processes. Moreover, ETS1/EWSR2 is implicated in the modulation of angiogenesis, orchestrating the expression of genes that govern endothelial cell migration and invasion. Additionally, this protein serves as a dominant-negative factor for isoform c-ETS-1A, further highlighting its intricate regulatory functions in cellular processes and immune responses.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P14921-5 (M1-T272)

Gene ID
Molecular Construction
N-term
6*His
ETS1 (M1-T272)
Accession # P14921-5
C-term
Protein Length

Full Length of Isoform-5

Synonyms
rHuProtein C-ets-1/ETS1, His; ETS1 Protein; Protein C-ets-1; V-ets Erythroblastosis Virus E26 Oncogene Homolog 1 (Avian); Isoform CRA_a; ETS1; hCG_1732038
AA Sequence

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT

Molecular Weight

Approximately 36 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ETS1/EWSR2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ETS1/EWSR2 Protein, Human (His)
Cat. No.:
HY-P70292
Quantity:
MCE Japan Authorized Agent: