ESM-1 Protein, Mouse (HEK293, His)

ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

ESM-1 (Endocan) plays a crucial role in angiogenesis, promoting the sprouting of new blood vessels. It is implicated in lung endothelial cell-leukocyte interactions, suggesting its potential significance in regulating immune responses within the pulmonary vasculature.

Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. Recombinant Mouse Endocan/ESM-1 immobilized at 25 μg/mL, 100 μL/well, will mediate 37.688% cell adhesion (100 μL/well at 0.5 x 10^6 cells/mL).

Mouse

HEK293

C-6*His

Q9QYY7 (W20-R184)

71690  [NCBI]

Full Length of Mature Protein

WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR

Approximately 20 kDa,based on SDS-PAGE under reducing conditions.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.