1. Recombinant Proteins
  2. Receptor Proteins
  3. Erythropoietin receptor/EpoR Protein, Mouse (sf9, Fc)

Erythropoietin receptor/EpoR Protein, Mouse (sf9, Fc)

Cat. No.: HY-P73033
Handling Instructions Technical Support

Erythropoietin receptor (EpoR) mediates erythropoietin-induced erythroblast proliferation and differentiation. After EPO stimulation, EpoR dimerizes, initiates the JAK2/STAT5 signaling cascade, and can activate STAT1, STAT3, and LYN tyrosine kinases in certain cell types. Erythropoietin receptor/EpoR Protein, Mouse (sf9, Fc) is the recombinant mouse-derived Erythropoietin receptor/EpoR protein, expressed by Sf9 insect cells , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Erythropoietin receptor (EpoR) mediates erythropoietin-induced erythroblast proliferation and differentiation. After EPO stimulation, EpoR dimerizes, initiates the JAK2/STAT5 signaling cascade, and can activate STAT1, STAT3, and LYN tyrosine kinases in certain cell types. Erythropoietin receptor/EpoR Protein, Mouse (sf9, Fc) is the recombinant mouse-derived Erythropoietin receptor/EpoR protein, expressed by Sf9 insect cells , with C-hFc labeled tag.

Background

Erythropoietin receptor (EpoR) serves as the key receptor for erythropoietin, orchestrating erythroblast proliferation and differentiation upon EPO stimulation. Through EpoR dimerization, it initiates the JAK2/STAT5 signaling cascade, leading to various cellular responses. In addition to activating STAT1 and STAT3 in specific cell types, EpoR may also engage the LYN tyrosine kinase. Upon EPO binding, EpoR forms homodimers and undergoes tyrosine phosphorylation, facilitating interactions with diverse SH2 domain-containing proteins such as LYN, APS, PTPN6, PTPN11, JAK2, PI3 kinases, STAT5A/B, SOCS3, CRKL, and ATXN2L. These interactions, intricate and multifaceted, modulate downstream signaling events, including mitogenic pathways and cell-surface expression. Notably, EpoR's interaction with NOSIP and the ubiquitin ligase NOSIP is implicated in EPO-induced cell proliferation, highlighting the regulatory complexity of EpoR-mediated signaling. Additionally, EpoR forms heterooligomers with FSFFV gp55 and associates with INPP5D/SHIP1, further expanding its functional repertoire in cellular processes.

Species

Mouse

Source

Sf9 insect cells

Tag

C-hFc

Accession

P14753 (A25-P249)

Gene ID
Molecular Construction
N-term
EpoR (A25-P249)
Accession # P14753
hFc
C-term
Synonyms
EpoR; EPO-R; Erythropoietin R; Erythropoietin receptor
AA Sequence

MDKLRVPLWPRVGPLCLLLAGAAWAPSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Molecular Weight

Approximately 58.6 kDa

Glycosylation
Yes
Purity

Greater than 85% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Erythropoietin receptor/EpoR Protein, Mouse (sf9, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Erythropoietin receptor/EpoR Protein, Mouse (sf9, Fc)
Cat. No.:
HY-P73033
Quantity:
MCE Japan Authorized Agent: