1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Erythropoietin Protein, Rat (sf9, His)

Epo protein is a hormone that plays a vital role in regulating red blood cell production in the body.It stimulates the differentiation and maturation of red blood cells in the bone marrow.Erythropoietin Protein, Rat (sf9, His) is the recombinant rat-derived Erythropoietin protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Epo protein is a hormone that plays a vital role in regulating red blood cell production in the body.It stimulates the differentiation and maturation of red blood cells in the bone marrow.Erythropoietin Protein, Rat (sf9, His) is the recombinant rat-derived Erythropoietin protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Epo Protein is a hormone primarily responsible for regulating the proliferation and differentiation of erythrocytes, as well as maintaining a balanced level of circulating erythrocyte mass. It accomplishes this by binding to its receptor, EPOR, which leads to the dimerization of EPOR and subsequent activation of JAK2. This activation triggers a cascade of signaling events involving specific downstream effectors such as STAT1 and STAT3. These pathways, including the RAS-MAPK and JAK-STAT5 pathways, contribute to the diverse functions of Epo Protein. Additionally, Epo Protein exists as a homodimer connected by disulfide bonds.

Species

Rat

Source

Sf9 insect cells

Tag

C-His

Accession

P29676-1 (A27-R192)

Gene ID
Molecular Construction
N-term
Erythropoietin (A27-R192)
Accession # P29676-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
ECYT5; EP; EPO; epoetin; Erythropoietin; MVCD2
AA Sequence

MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Predicted Molecular Mass
20 kDa
Molecular Weight

Approximately 27 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Erythropoietin Protein, Rat (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Erythropoietin Protein, Rat (sf9, His)
Cat. No.:
HY-P73040
Quantity:
MCE Japan Authorized Agent: