Erythropoietin/EPO Protein, Human (CHO)

Erythropoietin/EPO is a renal cytokine that activates Akt and NF-κB signaling pathways by binding to erythroid progenitor cells EPOR. Erythropoietin/EPO regulates erythroid proliferation and differentiation and inhibits apoptosis. Erythropoietin/EPO also has angiogenic ability comparable to VEGF and can stimulate endothelial cell capillary sprouting. Erythropoietin/EPO can be used in the study of ischemic heart diseases such as anemia in end-stage renal disease. Erythropoietin/EPO Protein, Human (CHO) is a recombinant Erythropoietin/EPO protein expressed in CHO cells with tag-free.

Erythropoietin/EPO is a glycoprotein mainly produced by the kidney and belongs to the cytokine superfamily. Erythropoietin/EPO binds to the erythropoietin receptor (EPOR) on erythroid progenitor cells (CFU-E and BFU-E), activates signaling pathways such as Akt and NF-κB, regulates erythrocyte proliferation and differentiation, promotes cell survival and inhibits apoptosis. Erythropoietin/EPO also has pro-angiogenic potential comparable to VEGF, can stimulate endothelial cell capillary sprouting, and protect tissues from ischemia-reperfusion injury by reducing apoptosis and inflammation. Clinically, recombinant human Erythropoietin/EPO (rh-EPO) can be used to study the inhibition of anemia in end-stage renal disease, and has potential application value in ischemic heart disease, nervous system damage and therapeutic angiogenesis.

The ED₅₀ is ≤2.299 ng/mL as measured in a cell proliferation assay using TF-1 human erythroleukemic cells, corresponding to a specific activity of ≥4.350× 10⁵ units/mg.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 1.136 ng/mL, corresponding to a specific activity is 8.803×10⁵ U/mg

Human

CHO

Tag Free

P01588 (A28-R193)

2056  [NCBI]

Full Length of Mature Protein

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Approximately 26-38 kDa due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Calvillo L, et al. Recombinant human erythropoietin protects the myocardium from ischemia-reperfusion injury and promotes beneficial remodeling. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4802-6.  [Content Brief]

  [2]. Jaquet K, et al. Erythropoietin and VEGF exhibit equal angiogenic potential. Microvasc Res. 2002 Sep;64(2):326-33.  [Content Brief]

  [3]. Stephenson JR, et al. Induction of colonies of hemoglobin-synthesizing cells by erythropoietin in vitro. Proc Natl Acad Sci U S A. 1971 Jul;68(7):1542-6.  [Content Brief]

  [4]. Kato M, et al. Pharmacokinetics and pharmacodynamics of recombinant human erythropoietin in rats. Arzneimittelforschung. 2001 Jan;51(1):91-5.  [Content Brief]

  [5]. Kato M, et al. Mechanism for the nonlinear pharmacokinetics of erythropoietin in rats. J Pharmacol Exp Ther. 1997 Nov;283(2):520-7.  [Content Brief]