1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. Estrogen Receptor
  5. ER-alpha
  6. ER alpha/ESR1 Protein, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE ER alpha/ESR1 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ER alpha/ESR1 Protein, a nuclear hormone receptor, plays a pivotal role in the regulation of eukaryotic gene expression, influencing cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves direct homodimer binding to palindromic estrogen response element (ERE) sequences or association with DNA-binding transcription factors like AP-1/c-Jun, c-Fos, ATF-2, Sp1, and Sp3, facilitating ERE-independent signaling. Upon ligand binding, ER alpha undergoes a conformational change, enabling subsequent association with multiprotein coactivator complexes through LXXLL motifs. Mutual transrepression occurs between ER alpha and NF-kappa-B in a cell-type specific manner, leading to decreased NF-kappa-B DNA-binding activity and inhibition of NF-kappa-B-mediated transcription. ER alpha is recruited to NF-kappa-B response elements, displacing coregulators and mediating transcriptional activation synergistically with NF-kappa-B. Moreover, ER alpha participates in membrane-initiated estrogen signaling through various kinase cascades, and is essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Additionally, ER alpha is involved in the activation of NOS3 and endothelial nitric oxide production. Isoforms lacking specific functional domains are believed to modulate transcriptional activity through competitive ligand or DNA binding, as well as heterodimerization with the full-length receptor. Furthermore, ER alpha binds to ERE and inhibits isoform 1.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human ESR1 is present at 10 μg/mL can bind Anti- ESR1 antibody. The ED50 for this effect is 0.445 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human ESR1 is present at 10 μg/mL can bind Anti- ESR1 antibody. The ED50 for this effect is 0.445 μg/mL.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P03372-1 (M1-Q116)

Gene ID
Molecular Construction
N-term
6*His
ESR1 (M1-Q116)
Accession # P03372-1
C-term
Protein Length

Partial

Synonyms
rHuEstrogen receptor/ER alpha, His; Estrogen Receptor; ER; ER-Alpha; Estradiol Receptor; Nuclear Receptor Subfamily 3 Group A Member 1; ESR1; ESR; NR3A1
AA Sequence

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Weight

Approximately 12-14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Glycine-HCl, 8% Sucrose, 0.05% Tween 80, pH 3.5 or 50 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ER alpha/ESR1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ER alpha/ESR1 Protein, Human (His)
Cat. No.:
HY-P70248
Quantity:
MCE Japan Authorized Agent: