1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-B3
  6. Ephrin B3 Protein, Rat (HEK293, Fc)

Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ephrin B3 protein is a member of the ephrin family and is characterized by the absence of conserved residue(s) crucial for the propagation of feature annotation. This distinctive feature suggests a unique molecular profile within the ephrin family, potentially influencing its functional properties and interactions. The specific role and implications of this divergence in conserved residues warrant further investigation to comprehend the functional nuances and cellular significance of Ephrin B3 in biological processes.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

G3V7D4 (L28-S224)

Gene ID
Molecular Construction
N-term
Ephrin B3 (L28-S224)
Accession # G3V7D4
hFc
C-term
Protein Length

Partial

Synonyms
Ephrin-B3; EPH-related receptor tyrosine kinase ligand 8; LERK-8; EFNB3; EPLG8
AA Sequence

MGGPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSQEPGKDSIPGDPNSNATSRGAEGPLPPPS

Predicted Molecular Mass
48.7 kDa
Molecular Weight

Approximately 55 kDa & 34 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin B3 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin B3 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73021
Quantity:
MCE Japan Authorized Agent: