1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-B1
  6. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His)

Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His)

Cat. No.: HY-P70374
Handling Instructions Technical Support

Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Background

Ephrin-B1/EFNB1, a cell surface transmembrane ligand for Eph receptors, plays a pivotal role in mediating contact-dependent bidirectional signaling during neuronal, vascular, and epithelial development. With high affinity for the receptor tyrosine kinase EPHB1/ELK, it also binds to EPHB2 and EPHB3. Binding to Eph receptors on neighboring cells initiates bidirectional signaling crucial for migration, repulsion, and adhesion. Additionally, EFNB1 is involved in inducing the collapse of commissural axons/growth cones in vitro and may contribute to constraining the orientation of longitudinally projecting axons. The protein interacts with GRIP1 and GRIP2 through its PDZ-binding motif and associates with TLE1. Moreover, the intracellular domain peptide of EFNB1 interacts with ZHX2, enhancing ZHX2's transcriptional repression activity.

Biological Activity

1. Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 27.43 ng/mL, corresponding to a specific activity is 3.65×104 U/mg.
2. Measured by its binding ability in a functional ELISA. Immobilized mouse EphB3 at 2 µg/mL (100 µL/well) can bind biotinylated mouse Ephrin-B1 Protein. The ED50 for this effect is 9.785-10.16 ng/mL.

  • Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 27.43 ng/mL, corresponding to a specific activity is 3.65×104 U/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc;C-6*His

Accession

P52795 (K30-S229)

Gene ID
Molecular Construction
N-term
EFNB1 (K30-S229)
Accession # P52795
hFc-6*His
C-term
Protein Length

Partial

Synonyms
rMuEphrin-B1/EFNB1, Fc-His; Ephrin-B1; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2; EFNB1; EFL3; EPLG2; LERK2
AA Sequence

KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

Molecular Weight

58-80 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His)
Cat. No.:
HY-P70374
Quantity:
MCE Japan Authorized Agent: