1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-B1
  6. Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)

Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)

Cat. No.: HY-P700609
Handling Instructions Technical Support

Ephrin-B1/EFNB1 Protein, a type I membrane protein, acts as a ligand for Eph-related receptor tyrosine kinases, potentially influencing cell adhesion and contributing to nervous system development. With ubiquitous expression, it is notably present in fat, placenta, and various tissues, showcasing its broad impact on diverse cellular and physiological contexts. Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-B1/EFNB1 Protein, a type I membrane protein, acts as a ligand for Eph-related receptor tyrosine kinases, potentially influencing cell adhesion and contributing to nervous system development. With ubiquitous expression, it is notably present in fat, placenta, and various tissues, showcasing its broad impact on diverse cellular and physiological contexts. Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ephrin-B1/EFNB1 Protein, a type I membrane protein, serves as a ligand for Eph-related receptor tyrosine kinases. Its involvement extends to potential roles in cell adhesion, contributing to the intricate processes of nervous system development or maintenance. Exhibiting ubiquitous expression, this protein is notably present in fat (RPKM 27.2), placenta (RPKM 17.2), and 23 other tissues, highlighting its wide-ranging influence across various cellular and physiological contexts.

Biological Activity

Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 2.876 ng/mL, corresponding to a specific activity is 3.4771×10^5 units/mg.

  • Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 2.876 ng/mL, corresponding to a specific activity is 3.4771×105 units/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

NP_004420.1 (L28-K237)

Gene ID
Molecular Construction
N-term
EFNB1 (L28-K237)
Accession # NP_004420.1
hFc
C-term
Protein Length

Partial

Synonyms
Ephrin-B1; EFL-3; ELK-L; LERK-2; Ephrin-B1 CTF; EFNB1; EFL3; EPLG2; LERK2
AA Sequence

LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSK

Molecular Weight

approximately 58.76 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-B1/EFNB1 Protein, Human (HEK293, C-hFc)
Cat. No.:
HY-P700609
Quantity:
MCE Japan Authorized Agent: