1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A4
  6. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His)

Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin-A4 (EFNA4) is a cell surface glycosylphosphatidylinositol (GPI)-bound ligand that belongs to the Eph receptor family, a group of receptor tyrosine kinases crucial for various developmental processes, including migration, repulsion, and adhesion in neurons, vascular tissues, and epithelial cells. EFNA4 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. This interaction is essential for orchestrating complex cellular events during development. Moreover, EFNA4 may contribute to the interaction between activated B-lymphocytes and dendritic cells in tonsils, suggesting its involvement in immune responses.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ephrin-A4 at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse EPHA7. The ED50 for this effect is 1.214μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse Ephrin-A4 at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse EPHA7. The ED50 for this effect is 1.214 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

O08542 (L26-G176)

Gene ID
Molecular Construction
N-term
EFNA4 (L26-G176)
Accession # O08542
His
C-term
Synonyms
Ephrin-A4; LERK-4; EFNA4; EPLG4
AA Sequence

LRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG

Molecular Weight

Approximately 25 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73011
Quantity:
MCE Japan Authorized Agent: