1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin A2
  6. Ephrin-A2/EFNA2 Protein, Mouse (HEK293)

Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A2/EFNA2 protein, a GPI-bound ligand, is vital in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. EFNA2 also activates EPHA8, impacting cellular processes and diverse developmental pathways. Ephrin-A2/EFNA2 Protein, Mouse (HEK293) is the recombinant mouse-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with tag free.

Background

The Ephrin-A2/EFNA2 protein, a cell surface GPI-bound ligand for Eph receptors, is integral to neuronal, vascular, and epithelial development, where Eph receptors play a crucial role in migration, repulsion, and adhesion. EFNA2 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling, with forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. In association with the EPHA2 receptor, EFNA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis. This protein also binds to the receptor tyrosine kinases EPHA3, EPHA4, and EPHA5. Furthermore, EFNA2 interacts with EPHA8, activating this receptor and potentially influencing additional cellular processes. The multifaceted interactions of EFNA2 underscore its significance in orchestrating complex signaling events that impact diverse developmental and regulatory pathways.

Biological Activity

Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 9.733 ng/mL, corresponding to a specific activity is 1.027×105 units/mg.

  • Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 9.733 ng/mL, corresponding to a specific activity is 1.027×105 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P52801 (R21-N184)

Gene ID
Molecular Construction
N-term
EFNA2 (R21-N184)
Accession # P52801
C-term
Synonyms
CEK7-ligand; CEK7-L; ELF-1; LERK-6
AA Sequence

RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN

Molecular Weight

Approximately 24-28 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A2/EFNA2 Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A2/EFNA2 Protein, Mouse (HEK293)
Cat. No.:
HY-P76910
Quantity:
MCE Japan Authorized Agent: