1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A1
  6. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His)

The Ephrin-A1/EFNA1 protein is a cell surface GPI-binding ligand of the Eph receptor and is involved in migration, repulsion, and adhesion during development. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ephrin-A1/EFNA1 protein is a cell surface GPI-binding ligand of the Eph receptor and is involved in migration, repulsion, and adhesion during development. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, assumes a crucial role in orchestrating migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Functioning as a promiscuous binder, Ephrin-A1 engages Eph receptors on adjacent cells, facilitating contact-dependent bidirectional signaling. Its significance extends to angiogenesis and tumor neovascularization, where the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2 is pivotal for EFNA1-induced RAC1 GTPase activation, vascular endothelial cell migration, and assembly. Furthermore, Ephrin-A1 exerts anti-oncogenic effects by activating and down-regulating EPHA2, inducing its internalization and degradation. In the context of gliomas, Ephrin-A1 acts as a negative regulator, down-regulating EPHA2 and FAK, thereby mitigating the tumorigenesis process. Beyond its role in angiogenesis and tumorigenesis, Ephrin-A1 can elicit the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as a monomer or homodimer, Ephrin-A1 forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases, including EPHA1, underscoring its diverse molecular interactions.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Ephrin-A1 at 10μg/mL (100 μL/well) can bind biotinylated EPHA2 Protein. The ED50 for this effect is 4.986 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Ephrin-A1 at 10 μg/mL (100 μL/well) can bind biotinylated EPHA2 Protein. The ED50 for this effect is 4.986 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

P97553 (A18-H181)

Gene ID
Molecular Construction
N-term
EFNA1 (A18-H181)
Accession # P97553
His
C-term
Protein Length

Partial

Synonyms
Ephrin-A1; LERK-1; TNF alpha-induced protein 4; EFNA1; EPLG1; TNFAIP4
AA Sequence

ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGH

Molecular Weight

Approximately 23 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A1/EFNA1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73025
Quantity:
MCE Japan Authorized Agent: