1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A1
  6. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand critical for migration, repulsion, and adhesion in developing neurons, blood vessels, and epithelia. It binds to nearby Eph receptors, initiating bidirectional signaling. Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, serves a pivotal role in migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, instigating contact-dependent bidirectional signaling. Crucial in angiogenesis and tumor neovascularization, EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration depend on the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2. Notably, EFNA1 exerts anti-oncogenic effects by activating and down-regulating EPHA2 through induced tyrosine phosphorylation, leading to internalization and degradation. In gliomas, it acts as a negative regulator, down-regulating EPHA2 and FAK and thus playing a role in suppressing tumorigenesis. EFNA1 can induce the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as both a monomer and homodimer, it forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases including EPHA1, EPHA3, EPHA4, EPHA5, EPHA6, and EPHA7.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P52793 (D19-S182)

Gene ID
Molecular Construction
N-term
EFNA1 (D19-S182)
Accession # P52793
His
C-term
Protein Length

Partial

Synonyms
Ephrin-A1; LERK-1; TNF alpha-induced protein 4; EFNA1; EPLG1; TNFAIP4
AA Sequence

MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS

Predicted Molecular Mass
20 kDa
Molecular Weight

Approximately 27 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A1/EFNA1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73024
Quantity:
MCE Japan Authorized Agent: