1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. Ephrin/Eph Family Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. Eph Receptors
  5. EphA7
  6. EphA7 Protein, Rat (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin A ligands (such as EFNA5). It affects brain development by regulating cell-cell adhesion and repulsion. EphA7 Protein, Rat (HEK293, His) is the recombinant rat-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin A ligands (such as EFNA5). It affects brain development by regulating cell-cell adhesion and repulsion. EphA7 Protein, Rat (HEK293, His) is the recombinant rat-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Background

EphA7 protein is a receptor tyrosine kinase that interacts with GPI-anchored ephrin-A ligands on adjacent cells, initiating bidirectional signaling. This contact-dependent signaling, known as forward signaling, occurs downstream of the receptor, while reverse signaling occurs downstream of the ephrin ligand. Among the ephrin-A ligands, EFNA5 specifically interacts with EphA7, influencing brain development by modulating cell-cell adhesion and repulsion. EphA7 also plays a role in axon guidance, facilitating the proper mapping of corticothalamic and retinal axons. Additionally, EphA7 may contribute to brain development through a proapoptotic activity that depends on caspase (CASP3). Activation of EphA7 can lead to phosphorylation of components of the ERK signaling pathway, including MAP2K1, MAP2K2, MAPK1, and MAPK3.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED50 for this effect is 212.3 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED50 for this effect is 212.3ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

P54759-1 (Q28-S539)

Gene ID
Molecular Construction
N-term
EphA7 (Q28-S539)
Accession # P54759-1
His
C-term
Protein Length

Partial

Synonyms
Ephrin Type-A Receptor 7; EPH Homology Kinase 3; EHK-3; EPH-Like Kinase 11; EK11; EPHA7; HEK11
AA Sequence

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEAS

Molecular Weight

Approximately 65-72 kDa.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EphA7 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76320
Quantity:
MCE Japan Authorized Agent: