1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Biotinylated Proteins
  3. Epithelial Cell Adhesion Molecule (EpCAM) Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD326/EpCAM
  5. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His)

EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His)

Cat. No.: HY-P77532
Handling Instructions Technical Support

SHP-2 protein is a phosphatase enzyme that plays a crucial role in cell signaling. It is involved in regulating cellular processes such as cell growth, differentiation, and survival. Dysregulation of SHP-2 protein has been implicated in various diseases, including cancer and developmental disorders. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SHP-2 protein is a phosphatase enzyme that plays a crucial role in cell signaling. It is involved in regulating cellular processes such as cell growth, differentiation, and survival. Dysregulation of SHP-2 protein has been implicated in various diseases, including cancer and developmental disorders. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The EpCAM/TROP1 Protein, belonging to a family that includes at least two type I membrane proteins, encodes a carcinoma-associated antigen expressed on most normal epithelial cells and gastrointestinal carcinomas. Functioning as a homotypic calcium-independent cell adhesion molecule, this antigen holds significance as a target for immunotherapy in the treatment of human carcinomas. Mutations in this gene are associated with congenital tufting enteropathy. The gene exhibits biased expression, with markedly elevated levels in the colon (RPKM 501.8), small intestine (RPKM 391.0), and nine other tissues, suggesting its specific involvement in various physiological contexts across multiple organs.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

NP_002345.1 (Q24-K265)

Gene ID
Molecular Construction
N-term
EpCAM (Q24-K265)
Accession # NP_002345.1
10*His
C-term
Protein Length

Extracellular domain

Synonyms
Epithelial cell adhesion molecule; Ep-CAM; EGP; KSA; CD326; TROP1
AA Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Predicted Molecular Mass
29 kDa
Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His)
Cat. No.:
HY-P77532
Quantity:
MCE Japan Authorized Agent: