1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Enterotoxin type B Protein, S. aureus (P.pastoris, His)

Enterotoxin type B Protein, S. aureus (P.pastoris, His)

Cat. No.: HY-P71808
Handling Instructions Technical Support

Enterotoxin B (SEB) is an antigen derived from Staphylococcus aureus (S. aureus) that can be recognized and bound by MHC class II molecules on antigen-presenting cells. Enterotoxin B also interacts with T cell receptors (TCRs), triggering massive activation of CD4+ and CD8+ T cells, leading to the release of proinflammatory cytokines (TNF-α, IFN-γ) and Th2-type cytokines (IL-4, IL-5, IL-13), regulating inflammatory responses. Enterotoxin B also exerts anti-tumor potential in fibrosarcoma models, inducing tumor necrosis. Enterotoxin type B Protein, S. aureus (P.pastoris, His) is a recombinant Enterotoxin B protein expressed by P. pastoris yeast with N-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Enterotoxin type B Protein, S. aureus (P.pastoris, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Enterotoxin B (SEB) is an antigen derived from Staphylococcus aureus (S. aureus) that can be recognized and bound by MHC class II molecules on antigen-presenting cells. Enterotoxin B also interacts with T cell receptors (TCRs), triggering massive activation of CD4+ and CD8+ T cells, leading to the release of proinflammatory cytokines (TNF-α, IFN-γ) and Th2-type cytokines (IL-4, IL-5, IL-13), regulating inflammatory responses. Enterotoxin B also exerts anti-tumor potential in fibrosarcoma models, inducing tumor necrosis. Enterotoxin type B Protein, S. aureus (P.pastoris, His) is a recombinant Enterotoxin B protein expressed by P. pastoris yeast with N-6*His tag.

Background

Enterotoxin type B, S. aureus is a superantigen of enterotoxin B (SEB) derived from Staphylococcus aureus (S. aureus), which belongs to the staphylococcal enterotoxin family. Enterotoxin B structurally binds to MHC class II molecules on antigen presenting cells and binds to the variable region of the β chain of the T cell receptor (TCR), activating T cells expressing a specific (Vβ)-TCR fragment. Enterotoxin B-TCR triggers massive activation of CD4+ and CD8+ T cells, leading to the release of proinflammatory cytokines (TNF-α, IFN-γ) and Th2-type cytokines (IL-4, IL-5, IL-13), and mediates the synthesis of nitric oxide (NO) through TNF and IFN-γ. The activity of enterotoxin B involves a regulatory loop in which NO downregulates cytokine production to prevent excessive inflammation. Enterotoxin B has been shown to induce TH2-biased cytokine release in a nasal polyp model; in an endotoxin shock model, NO-mediated protection against lethal cytokine storm was observed. In addition, intravenous administration of Enterotoxin B enhanced IFN-γ production and CD4+/CD8+ T cell infiltration, demonstrated anti-tumor potential in a fibrosarcoma model, and induced tumor necrosis.

In Vivo

Enterotoxin type B Protein, S. aureus (100 μg; intraperitoneal injection; 1 time; single dose) can induce a large amount of NO synthesis in the mouse endotoxin shock model. The synthesis of NO is regulated by TNF and IFN-γ. At the same time, endogenous NO can downregulate the production of TNF and IFN-γ and play a protective role. Inhibition of NO synthesis will lead to the death of mice, while neutralization of IFN-γ and TNF can reduce the mortality of mice[1].
Enterotoxin type B Protein, S. aureus (10 ng; intravenous injection; once every 3 days; 2 weeks) can significantly inhibit the tumor growth of the mouse fibrosarcoma model, increase the IFN-γ level and CD4+/CD8+ T cell infiltration rate, and induce tumor tissue necrosis, while intratumoral injection has no obvious tumor inhibition effect[2].

Biological Activity

Measured by its ability to induce IL-10 secretion by Raji cells. The ED50 for this effect is 53.25 ng/mL, corresponding to a specific activity is 1.878×10^4 U/mg.

  • Measured by its ability to induce IL-10 secretion by Raji cells. The ED50 for this effect is 53.25 ng/mL, corresponding to a specific activity is 1.878×10^4 U/mg.
Species

Staphylococcus aureus

Source

P. pastoris

Tag

N-6*His

Accession

P01552 (E28-K266)

Gene ID

/

Molecular Construction
N-term
6*His
SEB (E28-K266)
Accession # P01552
C-term
Protein Length

Full Length of Mature Protein

Synonyms
entBEnterotoxin type B; SEB
AA Sequence

ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Molecular Weight

Approximately 30.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Enterotoxin type B Protein, S. aureus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterotoxin type B Protein, S. aureus (P.pastoris, His)
Cat. No.:
HY-P71808
Quantity:
MCE Japan Authorized Agent: