1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. ENA-78
  6. ENA-78/CXCL5 Protein, Human

CXCL5, also known as neutrophil activating peptide 78 (ENA‐78), is a CXC chemokine containing ELR motif. CXCL5 promotes angiogenesis through interaction with its specific receptor CXCR2. CXCL5 is expressed by many immune cells, such as macrophages, eosinophils, and non-immune cells including mesothelial cells, and fibroblasts.CXCL5/CXCR2 axis not only contributes to the recruitment of neutrophils but also regulates the function of neutrophils in melanoma. ENA-78/CXCL5 Protein, Human is produced in E.coil, and consists of 70 amino acids (R45-N114).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL5, also known as neutrophil activating peptide 78 (ENA‐78), is a CXC chemokine containing ELR motif. CXCL5 promotes angiogenesis through interaction with its specific receptor CXCR2. CXCL5 is expressed by many immune cells, such as macrophages, eosinophils, and non-immune cells including mesothelial cells, and fibroblasts.CXCL5/CXCR2 axis not only contributes to the recruitment of neutrophils but also regulates the function of neutrophils in melanoma[1][2]. ENA-78/CXCL5 Protein, Human is produced in E.coil, and consists of 70 amino acids (R45-N114).

Background

CXCL5 belongs to the CXC-type chemokine family with a specific amino acid sequence of glutamic acid-leucine-arginine which is shortly named as ELR motif. The ELR motif of CXC-type chemokine family plays an important role in angiogenesis. CXCL5 is expressed by many immune cells, such as macrophages, eosinophils, as well as non-immune cells including mesothelial cells, and fibroblasts[1][2].
Human CXCL5 shares 57% amino acid sequence identity with mouse and rat CXCL5.
CXCL5 can recruit cells, such as T/B lymphocytes and eosinophils from the immune system to the corresponding regions during immune response. Besides, it also participates in promoting the adhesion and remodeling of connective tissues. CXCL5 is highly expressed in various tumor tissues. CXCL5 can be used as a potential indicator of tumor prognosis. In tumor microenvironment (TME), CXCL5 binds to its receptors, such as CXCR2, to participate in the recruitment of immune cells and promote angiogenesis, tumor growth, and metastasis. Mesenchymal stem cells (MSCs) activated by acidic TME or TNF-α can secrete CXCL5 and other pro-inflammatory factors. Besides, cancer-associated mesothelial cells, which are generated by plasminogen activator inhibitor-1 (PAI-1), can secrete IL-8 and CXCL5 via the NF-κB signaling pathway and thereby promoting peritoneal metastasis. Adipose tissue-derived stem cells (ASCs) secrete CXCL5 which subsequently promotes tumor growth and affects the development of breast tumors[2].
The CXCL5/CXCR2 axis recruits neutrophils, promotes angiogenesis and remodels connective tissues. In addition, CXCL5 promotes angiogenesis via activating the AKT/NF-κB/FOXD1/VEGF-A pathway in a CXCR2-dependent manner. CXCL5 plays a role in cancer cell proliferation, migration, and invasion. CXCL5 promotes the proliferation of several types of tumor cells, such as the tumor cells in prostate cancer, cervical cancer, lung cancer, hepatoblastoma, and osteosarcoma[1][2][3].

In Vivo

Recombinant human CXCL5 protein (1 ng/mL; 24-48 h) promotes proliferation, migration and partial invasion in Caco-2, HT-29 and SW-480 cells[1].
Recombinant human CXCL5 protein (1-10 ng/mL; 36 h) stimulates the formation ability, proliferation, and migration in HUVECs, which are enhanced by the activation of the AKT/NF-κB/FOXD1/VEGF-A pathway in a CXCR2-dependent manner[3].

Biological Activity

1.The ED50 is <50 ng/mL as measured by CHO-K1/Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells).
2.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 6.072 ng/mL, corresponding to a specific activity is 1.647×105 U/mg.

  • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 6.072 ng/mL, corresponding to a specific activity is 1.647×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P42830 (R45-N114)

Gene ID
Molecular Construction
N-term
ENA-78 (R45-N114)
Accession # P42830
C-term
Protein Length

Partial

Synonyms
rHuENA-78/CXCL5; ENA78; SCYB5
AA Sequence

RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Predicted Molecular Mass
7.7 kDa
Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

ENA-78/CXCL5 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ENA-78/CXCL5 Protein, Human
Cat. No.:
HY-P7158
Quantity:
MCE Japan Authorized Agent: