1. Recombinant Proteins
  2. Others
  3. EIF5A2 Protein, Human (His)

EIF5A2 is a translation factor critical for promoting elongation and termination, helping stalled ribosomes encounter specific amino acid environments. EIF5A2 is located between the ribosome exit (E) and peptidyl (P) sites and rescues stalled ribosomes, especially those translating polyproline-containing peptides. EIF5A2 Protein, Human (His) is the recombinant human-derived EIF5A2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EIF5A2 is a translation factor critical for promoting elongation and termination, helping stalled ribosomes encounter specific amino acid environments. EIF5A2 is located between the ribosome exit (E) and peptidyl (P) sites and rescues stalled ribosomes, especially those translating polyproline-containing peptides. EIF5A2 Protein, Human (His) is the recombinant human-derived EIF5A2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

EIF5A2, a translation factor, plays a pivotal role in promoting translation elongation and termination, especially when ribosomes encounter specific amino acid sequence contexts leading to stalling. Positioned between the exit (E) and peptidyl (P) sites of the ribosome, EIF5A2 facilitates the rescue of stalled ribosomes, particularly those translating polyproline-containing peptides and other motifs causing ribosomal stalling. Additionally, EIF5A2 serves as a cofactor in ribosome quality control (RQC), aiding the RQC complex in the peptidyl transfer during the CAT tailing step. Beyond its role in translation, EIF5A2 is implicated in actin dynamics, cell cycle progression, mRNA decay, and likely participates in stress response and cell wall integrity maintenance. It exhibits mutually exclusive binding with EEF2/eEF2 on actively translating ribosomes. Notably, EIF5A2 interacts with DAPL1, forming a complex at the polypeptide exit tunnel of hibernating ribosomes, thereby preventing translation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9GZV4 (M1-K153)

Gene ID
Molecular Construction
N-term
6*His
EIF5A2 (M1-K153)
Accession # Q9GZV4
C-term
Protein Length

Full Length

Synonyms
Eukaryotic translation initiation factor 5A-2; Eukaryotic initiation factor 5A isoform 2; EIF5A2
AA Sequence

MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK

Predicted Molecular Mass
18.9 kDa
Molecular Weight

Approximately 22 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EIF5A2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF5A2 Protein, Human (His)
Cat. No.:
HY-P70910
Quantity:
MCE Japan Authorized Agent: