EIF1B Protein, Human (His)

EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag.

EIF1B protein is likely intricately involved in the complex process of translation, playing a crucial role in facilitating the accurate and efficient synthesis of proteins within the cellular machinery. Its participation in translation suggests a key function in orchestrating the various steps required for the proper decoding of mRNA and subsequent assembly of polypeptide chains.

Human

E. coli

N-6*His

O60739 (M1-F113)

10289  [NCBI]

Full Length

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

Approximately 16 kDa,based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.