1. Recombinant Proteins
  2. Others
  3. EIF1AX Protein, Human (His)

The EIF1AX protein is an important member of the 43S preinitiation complex (43S PIC) and is responsible for coordinating mRNA cap-proximal binding, scanning the 5'-untranslated region, and pinpointing the start codon. EIF1AX Protein, Human (His) is the recombinant human-derived EIF1AX protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EIF1AX protein is an important member of the 43S preinitiation complex (43S PIC) and is responsible for coordinating mRNA cap-proximal binding, scanning the 5'-untranslated region, and pinpointing the start codon. EIF1AX Protein, Human (His) is the recombinant human-derived EIF1AX protein, expressed by E. coli , with N-6*His labeled tag.

Background

EIF1AX is a crucial component of the 43S pre-initiation complex (43S PIC), playing a pivotal role in the initiation of protein synthesis. As part of the 43S PIC, EIF1AX binds to the mRNA cap-proximal region, facilitates scanning of the mRNA 5'-untranslated region, and locates the initiation codon. Working in concert with EIF1, EIF1AX enhances the formation of the cap-proximal complex and aids in scanning, start codon recognition, assembly of the 48S complex at the initiation codon, and dissociation of aberrant complexes. Following the location of the start codon, EIF1AX collaborates with EIF5B to orient the initiator methionine-tRNA in a conformation conducive to 60S ribosomal subunit joining, forming the 80S initiation complex. EIF1AX is released after 80S initiation complex formation, occurring just after GTP hydrolysis by EIF5B and preceding the release of EIF5B. Its globular part is situated in the A site of the 40S ribosomal subunit. Interactions with EIF5 and EIF5B during scanning contribute to the maintenance of EIF1 within the open 43S PIC, highlighting EIF1AX's multifaceted role in the complex process of translation initiation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P47813 (M1-I144)

Gene ID
Molecular Construction
N-term
6*His
EIF1AX (M1-I144)
Accession # P47813
C-term
Synonyms
rHuEukaryotic translation initiation factor 1A, X-chromosomal/EIF1AX, His; Eukaryotic Translation Initiation Factor 1A X-Chromosomal; eIF-1A X Isoform; Eukaryotic Translation Initiation Factor 4C; eIF-4C; EIF1AX; EIF1A; EIF4C
AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Molecular Weight

Approximately 22.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EIF1AX Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF1AX Protein, Human (His)
Cat. No.:
HY-P70355
Quantity:
MCE Japan Authorized Agent: