1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His)

EGLP/GPX5 may constitute a protective system similar to glutathione peroxidase, protecting sperm membrane lipids from peroxidative damage. Despite the limited enzyme activity, the protective effect suggests an effect beyond enzyme function. EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His) is the recombinant pig-derived EGLP/GPX5 protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EGLP/GPX5 may constitute a protective system similar to glutathione peroxidase, protecting sperm membrane lipids from peroxidative damage. Despite the limited enzyme activity, the protective effect suggests an effect beyond enzyme function. EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His) is the recombinant pig-derived EGLP/GPX5 protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

Background

The EGLP/GPX5 protein emerges as a potential constituent of a protective system akin to glutathione peroxidase, safeguarding sperm membrane lipids against peroxide damage. Despite the limited enzymatic activity towards hydrogen peroxide or organic hydroperoxides exhibited by the purified porcine enzyme, the protective effect suggests a role beyond enzymatic function. Instead, EGLP/GPX5 may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides. This binding action could prevent the interaction of lipid peroxides with phospholipase A2, thereby mitigating the induction of the acrosome reaction. The multifaceted nature of EGLP/GPX5 implies its involvement in non-enzymatic mechanisms that contribute to the defense against peroxide-induced damage, highlighting its potential significance in preserving sperm viability and functionality. Further investigation is essential to unravel the specific molecular pathways and interactions orchestrated by EGLP/GPX5 in this protective capacity.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Pig

Source

P. pastoris

Tag

N-His;C-Myc

Accession

O18994 (N22-E219)

Gene ID
Molecular Construction
N-term
6*His
EGLP (N22-E219)
Accession # O18994
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
GPX5; Epididymal secretory glutathione peroxidase; EGLP; Glutathione peroxidase 5; GPx-5; GSHPx-5
AA Sequence

NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Molecular Weight

Approximately 26.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGLP/GPX5 Protein, Pig (P.pastoris, Myc, His)
Cat. No.:
HY-P71739
Quantity:
MCE Japan Authorized Agent: