1. Recombinant Proteins
  2. Others
  3. EEF1E1 Protein, Human (His)

The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag.

Background

EEF1E1, a positive modulator of the ATM response to DNA damage, is a crucial component of a multisubunit complex that orchestrates tRNA ligases for Arg (RARS1), Asp (DARS1), Gln (QARS1), Ile (IARS1), Leu (LARS1), Lys (KARS1), Met (MARS1), and the bifunctional ligase for Glu and Pro (EPRS1), along with the auxiliary subunits AIMP1/p43, AIMP2/p38, and EEF1E1/p18. It forms a linear complex containing MARS1, EEF1E1, EPRS1, and AIMP2 at its core. EEF1E1 exhibits simultaneous interaction with MARS1 and EPRS1, highlighting its integral role in the multisubunit complex. Additionally, EEF1E1 interacts with ATM and ATR. The interaction with ATM, independent of TP53, is induced by DNA damage resulting from genotoxic stress or cell growth, while the interaction with ATR is heightened in response to UV irradiation. This intricate network underscores EEF1E1's significance in coordinating DNA damage response mechanisms.

Species

Human

Source

E. coli

Tag

N-His

Accession

O43324 (M1-H174)

Gene ID
Molecular Construction
N-term
His
EEF1E1 (M1-H174)
Accession # O43324
C-term
Protein Length

Full Length

Synonyms
Eukaryotic translation elongation factor 1 epsilon-1; AIMP3; P18
AA Sequence

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Molecular Weight

Approximately 22 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EEF1E1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EEF1E1 Protein, Human (His)
Cat. No.:
HY-P76314
Quantity:
MCE Japan Authorized Agent: