1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. EDA2R
  6. EDA2R/XEDAR Protein, Cynomolgus (HEK293, His)

The EDA2R/XEDAR proteins lack conserved residues critical for feature annotation propagation and exhibit unique characteristics that raise questions about their structural and functional aspects. This uniqueness suggests potential changes in molecular interactions and signaling pathways. EDA2R/XEDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EDA2R/XEDAR proteins lack conserved residues critical for feature annotation propagation and exhibit unique characteristics that raise questions about their structural and functional aspects. This uniqueness suggests potential changes in molecular interactions and signaling pathways. EDA2R/XEDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-His labeled tag.

Background

EDA2R, also known as XEDAR, presents a distinctive feature as it lacks conserved residue(s) necessary for the propagation of feature annotation. This unique characteristic raises intriguing questions about the structural and functional aspects of EDA2R, hinting at potential variations in its molecular interactions and signaling pathways. The absence of these conserved residues highlights the need for in-depth investigations to elucidate the specific roles and regulatory mechanisms associated with EDA2R, shedding light on its contributions to cellular processes and biological functions.

Biological Activity

Immobilized Recombinant Human EDA-A2 at 1 μg/mL (100 μL/well) can bind Recombinant Cynomolgus EDA2R. The ED50 for this effect is 153.9 ng/mL.

  • Immobilized Recombinant Human EDA-A2 at 1 μg/ml (100 μL/well) can bind Recombinant Cynomolgus EDA2R. The ED50 for this effect is 153.9 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XP_005593864.1 (M1-E136)

Gene ID
Molecular Construction
N-term
EDA2R (M1-E136)
Accession # XP_005593864.1
His
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 27; EDA-A2 receptor; EDA2R; TNFRSF27; XEDAR
AA Sequence

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQEQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQE

Molecular Weight

Approximately 25-29 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EDA2R/XEDAR Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EDA2R/XEDAR Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77353
Quantity:
MCE Japan Authorized Agent: