ECM1 Protein, Human (HEK293, His)

ECM1 Protein, Human (HEK293, His) is the recombinant human-derived ECM1 protein, expressed by HEK293, with C-His tag.

ECM1, a multifaceted protein, serves as a crucial participant in endochondral bone formation, acting as a negative regulator of bone mineralization. Beyond its role in bone development, ECM1 demonstrates its influence on vascular processes by stimulating endothelial cell proliferation and promoting angiogenesis. Furthermore, the protein exhibits inhibitory effects on MMP9 proteolytic activity, revealing its regulatory function in extracellular matrix remodeling. ECM1 engages in various molecular interactions, including binding to HSPG2 via its C-terminus and forming complexes with EFEMP1/FBLN3 and LAMB3. Additionally, ECM1 interacts directly with MMP9, emphasizing its involvement in the modulation of matrix metalloproteinase activity. The diverse roles and interactions of ECM1 underscore its significance in orchestrating processes related to bone formation and vascular function.

Human

HEK293

C-His

Q16610-1 (M1-E540)

1893

Full Length of Isoform-1

MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE

Predicted band size: 60.2 kDa; Observed band size: 80-90 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.