1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. ECH1 Protein, Human (His)

ECH1 Protein plays a crucial role in isomerization, converting 3-trans,5-cis-dienoyl-CoA to its isomeric form, 2-trans,4-trans-dienoyl-CoA. This enzymatic step is vital in metabolic pathways, ensuring the equilibrium of dienoyl-CoA species and contributing to overall metabolic flux. ECH1's activity is essential for maintaining structural rearrangement in Coenzyme A (CoA)-linked intermediates, emphasizing its significance in cellular processes. ECH1 Protein, Human (His) is the recombinant human-derived ECH1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE ECH1 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ECH1 Protein plays a crucial role in isomerization, converting 3-trans,5-cis-dienoyl-CoA to its isomeric form, 2-trans,4-trans-dienoyl-CoA. This enzymatic step is vital in metabolic pathways, ensuring the equilibrium of dienoyl-CoA species and contributing to overall metabolic flux. ECH1's activity is essential for maintaining structural rearrangement in Coenzyme A (CoA)-linked intermediates, emphasizing its significance in cellular processes. ECH1 Protein, Human (His) is the recombinant human-derived ECH1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ECH1 plays a crucial role in the enzymatic process of isomerization, specifically converting 3-trans,5-cis-dienoyl-CoA into its isomeric form, 2-trans,4-trans-dienoyl-CoA. This isomerization step is essential in various metabolic pathways where Coenzyme A (CoA)-linked intermediates undergo structural rearrangement. ECH1's ability to catalyze this isomeric transformation contributes to the overall metabolic flux, highlighting its significance in maintaining the equilibrium of dienoyl-CoA species in cellular processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q13011 (T34-L328)

Gene ID
Molecular Construction
N-term
6*His
ECH1 (T34-L328)
Accession # Q13011
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuDelta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial/ECH1, His; Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase; mitochondrial; ECH1;
AA Sequence

TGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL

Molecular Weight

30-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 8% trehalose, 0.05% Tween 80, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

ECH1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ECH1 Protein, Human (His)
Cat. No.:
HY-P70059
Quantity:
MCE Japan Authorized Agent: