1. Recombinant Proteins
  2. Viral Proteins
  3. Ebola Virus Proteins
  4. Ebola Virus VP40
  5. Ebola virus VP40/Matrix VP40 Protein (AHX24648, His)

Ebola virus VP40/Matrix VP40 Protein (AHX24648, His)

Cat. No.: HY-P76891
Handling Instructions Technical Support

Ebola virus VP40 (matrix VP40 protein) centrally directs virus assembly and budding and has complex interactions with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TGS101). Ebola virus VP40/Matrix VP40 Protein (AHX24648, His) is the recombinant Virus-derived Ebola virus VP40/Matrix VP40 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ebola virus VP40 (matrix VP40 protein) centrally directs virus assembly and budding and has complex interactions with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TGS101). Ebola virus VP40/Matrix VP40 Protein (AHX24648, His) is the recombinant Virus-derived Ebola virus VP40/Matrix VP40 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The Ebola virus VP40, also known as Matrix VP40 protein, plays a central role in virus particle assembly and budding, orchestrating intricate interactions with both viral and host components. It functions by interacting with the viral ribonucleocapsid and members of the host ESCRT system, including VPS4, PDCD6IP/ALIX, NEDD4, or TGS101, essential for efficient budding. Additionally, its association with the host E3 ubiquitin ligase SMURF2 facilitates virus budding. Notably, VP40 may contribute to immune cell dysfunction by being packaged into exosomes, diminishing the viability of recipient cells through RNAi suppression and exosome-bystander apoptosis. Existing in various oligomeric forms, such as homodimers, homohexamers critical for budding, and homooctamers involved in genome replication and RNA binding, VP40 undergoes dynamic structural transitions upon reorganization at the plasma membrane into a hexameric form using phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2). These hexamers are crucial for the budding process, while octamers play a role in genome replication and RNA binding. VP40 further interacts with host factors including TSG101, NEDD4, PDCD6IP/ALIX, SMURF2, ITCH, and nucleoprotein/NP, highlighting its pivotal role in governing virus assembly and egress.

Species

Virus

Source

E. coli

Tag

N-6*His

Accession

AHX24648 (N31-K326)

Gene ID

/

Molecular Construction
N-term
6*His
EBOV VP40 (N31-K326)
Accession # AHX24648
C-term
Protein Length

Partial

Synonyms
Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Matrix protein VP40 Protein (His)
AA Sequence

NSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVVEK

Molecular Weight

Approximately 34.1 kDa.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ebola virus VP40/Matrix VP40 Protein (AHX24648, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ebola virus VP40/Matrix VP40 Protein (AHX24648, His)
Cat. No.:
HY-P76891
Quantity:
MCE Japan Authorized Agent: