1. Recombinant Proteins
  2. Viral Proteins
  3. Ebola Virus Proteins
  4. Ebola Virus NP
  5. Ebola virus NP/Nucleoprotein Protein (109a.a, Q5XX08, His)

Ebola virus NP/Nucleoprotein Protein (109a.a, Q5XX08, His)

Cat. No.: HY-P75725
Handling Instructions Technical Support

The Ebola virus NP/nucleoprotein is critical for viral genome protection and replication, forming a helical capsid to protect the genome. The VP35 interaction stabilizes the monomeric NP, maintaining solubility until replication triggers cooperative binding to viral RNA. Ebola virus NP/Nucleoprotein Protein (109a.a, Q5XX08, His) is the recombinant Virus-derived Ebola virus NP/Nucleoprotein protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ebola virus NP/nucleoprotein is critical for viral genome protection and replication, forming a helical capsid to protect the genome. The VP35 interaction stabilizes the monomeric NP, maintaining solubility until replication triggers cooperative binding to viral RNA. Ebola virus NP/Nucleoprotein Protein (109a.a, Q5XX08, His) is the recombinant Virus-derived Ebola virus NP/Nucleoprotein protein, expressed by E. coli , with N-His labeled tag.

Background

Ebola virus NP/Nucleoprotein Protein plays a pivotal role in viral genome protection and replication by oligomerizing into a helical capsid that encapsidates the viral genome, shielding it from cellular nucleases and the innate immune response. The interaction with VP35 stabilizes monomeric NP, maintaining its solubility until virus replication triggers the cooperative binding of NP to viral genomic RNA, leading to the release of VP35. This encapsidated genomic RNA, forming the nucleocapsid, serves as a template for transcription and replication, featuring a helical structure with a pitch of 10.81 NP per turn and a diameter of approximately 22nm. NP binds to six nucleotides of viral genomic RNA, with three exposed to the solvent and three hidden within the nucleocapsid. Furthermore, NP recruits the host PPP2R5C phosphatase to dephosphorylate VP30, promoting viral transcription. During virion assembly, NP interacts with VP24 and potentially host STAU1, facilitating nucleocapsid assembly and genome packaging. Additionally, interactions with VP40, host NXF1, and CCDC92 further contribute to the multifaceted functions of NP in the Ebola virus life cycle.

Species

Virus

Source

E. coli

Tag

N-His

Accession

Q5XX08 (G630-D738)

Gene ID

3160777  [NCBI]

Molecular Construction
N-term
His
EBOV NP (G630-D738)
Accession # Q5XX08
C-term
Protein Length

Partial

Synonyms
Ebola virus EBOV (Sudan ebolAvirus, strain Gulu) Nucleoprotein / NP Protein (His)
AA Sequence

GQGSESEALPINPEKGSALEETYYHLLKTQGPFEAINYYHLMSDEPIAFSTESGKEYIFPDSLEEAYPPWLSEKEALEKENRYLVIDGQQFLWPVMSLQDKFLAVLQHD

Molecular Weight

Approximately 14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ebola virus NP/Nucleoprotein Protein (109a.a, Q5XX08, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ebola virus NP/Nucleoprotein Protein (109a.a, Q5XX08, His)
Cat. No.:
HY-P75725
Quantity:
MCE Japan Authorized Agent: