1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. E-Selectin/CD62E Selectin
  5. E-Selectin/CD62E
  6. E-selectin/CD62E Protein, Cynomolgus (HEK293, His)

E-selectin/CD62E Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P75220
Handling Instructions Technical Support

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells. As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion. E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells. As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion. E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

Background

The E-selectin/CD62E Protein is a vital member of the selectin/LECAM family, signifying its significant role in cell adhesion processes. As part of this family, E-selectin likely shares conserved structural and functional features with related proteins, indicating its involvement in mediating interactions between leukocytes and endothelial cells. The classification within the selectin/LECAM family underscores its specific designation within the broader context of cell adhesion molecules, providing insights into its unique contributions to cellular adhesion. The study of E-selectin/CD62E contributes to our understanding of its role in inflammatory responses and immune cell trafficking, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in immune surveillance and inflammation. Further exploration of E-selectin/CD62E's role holds promise for enhancing our knowledge of its contributions to normal physiology and pathological conditions.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 29.560 ng/mL, corresponding to a specific activity is 3.392×104 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 29.560 ng/mL, corresponding to a specific activity is 3.392×104 units/mg.
Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

G8F370 (W22-P556)

Gene ID

/

Molecular Construction
N-term
CD62E (W22-P556)
Accession # G8F370
His
C-term
Protein Length

Partial

Synonyms
E-selectin; ELAM-1; LECAM2; CD63E; SELE
AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP

Molecular Weight

95-115 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

E-selectin/CD62E Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
E-selectin/CD62E Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P75220
Quantity:
MCE Japan Authorized Agent: