1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Phosphatase
  4. Protein tyrosine phosphatases
  5. Dual Specificity Protein Phosphatase 14 (DUSP14)
  6. DUSP14 Protein, Human (His)

DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

Background

The DUSP14 Protein assumes a crucial role in the inactivation of MAP kinases, exhibiting dephosphorylation activity towards ERK, JNK, and p38 MAP-kinases. Its negative regulatory function extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, leading to its inactivation. This mechanism underscores DUSP14's role in modulating the TCR signaling pathway, revealing its involvement in regulating immune responses. The dephosphorylation activity of DUSP14 on key components of MAP kinase cascades highlights its capacity to finely tune cellular signaling, with potential implications for various physiological processes influenced by MAP kinase pathways.

Biological Activity

Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is ≤8.219 ng/mL, corresponding to a specific activity is ≥1.217×105 units/mg.

  • Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 5.031 ng/mL, corresponding to a specific activity is 1.988×105 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

O95147 (M1-H191)

Gene ID
Molecular Construction
N-term
His
DUSP14 (M1-H191)
Accession # O95147
C-term
Protein Length

Partial

Synonyms
Dual specificity protein phosphatase 14; MKP-L; MKP-6; DUSP14
AA Sequence

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH

Molecular Weight

Approximately 21-23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DUSP14 Protein, Human (His)
Cat. No.:
HY-P76307
Quantity:
MCE Japan Authorized Agent: