1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Death Receptor 6
  6. DR6/TNFRSF21 Protein, Rat (HEK293, Fc)

DR6/TNFRSF21 protein is the core of apoptosis and may activate NF-kappa-B and promote BAX-mediated apoptosis through cytochrome c release. In neuronal apoptosis, it responds to amyloid peptides in APP, which is critical for cell body death and axonal pruning. DR6/TNFRSF21 Protein, Rat (HEK293, Fc) is the recombinant rat-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DR6/TNFRSF21 protein is the core of apoptosis and may activate NF-kappa-B and promote BAX-mediated apoptosis through cytochrome c release. In neuronal apoptosis, it responds to amyloid peptides in APP, which is critical for cell body death and axonal pruning. DR6/TNFRSF21 Protein, Rat (HEK293, Fc) is the recombinant rat-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

DR6/TNFRSF21 protein plays a pivotal role in promoting apoptosis, potentially through a pathway involving the activation of NF-kappa-B. It can also facilitate apoptosis mediated by BAX and the release of cytochrome c from mitochondria into the cytoplasm. This protein is actively involved in neuronal apoptosis, responding to amyloid peptides derived from APP, and is crucial for normal cell body death and axonal pruning. Trophic-factor deprivation triggers the cleavage of surface APP by beta-secretase, releasing sAPP-beta, which binds TNFRSF21, subsequently activating caspases and inducing degeneration of both neuronal cell bodies (via caspase-3) and axons (via caspase-6). In addition to its role in neuronal processes, DR6/TNFRSF21 negatively regulates oligodendrocyte survival, maturation, and myelination. Furthermore, it plays a role in T-cell receptor-mediated signaling, adaptive immune responses, and the regulation of T-cell differentiation and proliferation, exhibiting negative regulatory effects on cytokine release and antibody production. Additionally, DR6/TNFRSF21 acts as a regulator of pyroptosis by recruiting CASP8 in response to reactive oxygen species, leading to the activation of GSDMC. It interacts with TRADD, NGFR, CASP8, and N-APP in the intricate network of its molecular functions.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human APP Protein is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Rat DR6/TNFRSF21 Protein. The ED50 for this effect is 98.85 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human APP Protein is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Rat DR6/TNFRSF21 Protein. The ED50 for this effect is 98.85 ng/mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

D3ZF92 (Q42-H349)

Gene ID
Molecular Construction
N-term
DR6 (Q42-H349)
Accession # D3ZF92
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor necrosis factor receptor superfamily member 21; CD358; Tnfrsf21; DR6
AA Sequence

QPEQKTLSLTGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPSGTFTRHENGIERCHDCSQPCPRPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCRAHTDCLGQNLMVVKQGTKETDNVCGVHLSSSSTTPSSPGIATFSHPEHTESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSDIQEETVPDNTSSTSGKESTNRTLPNPPQLTHQQGPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNPHKHFDINEH

Molecular Weight

Approximately 95-115 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DR6/TNFRSF21 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DR6/TNFRSF21 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75277
Quantity:
MCE Japan Authorized Agent: