1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Death Receptor 6
  6. DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His)

The DR6/TNFRSF21 protein participates in multiple cellular processes and promotes apoptosis through NF-kappa-B activation, BAX-mediated pathways, and cytochrome c release. It is critical for neuronal apoptosis, particularly in response to APP-derived amyloid peptides, and is critical for normal cell body death and axonal pruning. DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DR6/TNFRSF21 protein participates in multiple cellular processes and promotes apoptosis through NF-kappa-B activation, BAX-mediated pathways, and cytochrome c release. It is critical for neuronal apoptosis, particularly in response to APP-derived amyloid peptides, and is critical for normal cell body death and axonal pruning. DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Background

The DR6/TNFRSF21 Protein is involved in multiple cellular processes. It promotes apoptosis through various pathways, including activation of NF-kappa-B, BAX-mediated apoptosis, and release of cytochrome c from mitochondria. It plays a crucial role in neuronal apoptosis, particularly in response to amyloid peptides derived from APP, and is essential for normal cell body death and axonal pruning. Additionally, it regulates oligodendrocyte survival, maturation, and myelination negatively. In the context of the adaptive immune response, it participates in signaling cascades triggered by T-cell receptors, influencing T-cell differentiation, proliferation, and cytokine release. Moreover, it inhibits JNK activation upon T-cell stimulation and negatively regulates IgG, IgM, and IgM production in response to antigens. It also functions as a regulator of pyroptosis, recruiting CASP8 in response to reactive oxygen species and oxidation, leading to GSDMC activation. The DR6/TNFRSF21 Protein interacts with NGFR, CASP8, and N-APP, and associates with TRADD.

Species

Mouse

Source

HEK293

Tag

C-hFc;C-6*His

Accession

Q9EPU5 (Q42-H349)

Gene ID
Molecular Construction
N-term
DR6 (Q42-H349)
Accession # Q9EPU5
hFc-6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor necrosis factor receptor superfamily member 21; CD358; Tnfrsf21; DR6
AA Sequence

QPEQKTLSLPGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNMSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCKAHTDCLGQNLEVVKPGTKETDNVCGMRLFFSSTNPPSSGTVTFSHPEHMESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSGIEEGTVPDNTSSTSGKEGTNRTLPNPPQVTHQQAPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNAHKHFDINEH

Predicted Molecular Mass
64.7 kDa
Molecular Weight

Approximately 75-120 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His)
Cat. No.:
HY-P72664
Quantity:
MCE Japan Authorized Agent: