1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Death Receptor 3
  6. DR3/TNFRSF25 Protein, Human (HEK293, Fc)

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, Fc) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, Fc) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

DR3/TNFRSF25 Protein serves as the receptor for TNFSF12/APO3L/TWEAK and directly interacts with the adapter TRADD. This interaction leads to the activation of NF-kappa-B and induction of apoptosis. The protein may play a crucial role in regulating lymphocyte homeostasis. It forms homodimers and exhibits strong interactions via the death domains with TNFRSF1 and TRADD, initiating distinct signaling cascades involved in apoptosis and NF-kappa-B signaling. Additionally, DR3/TNFRSF25 interacts with BAG4, contributing to its multifaceted roles in cellular responses.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q93038 (Q25-F201)

Gene ID
Molecular Construction
N-term
DR3 (Q25-F201)
Accession # Q93038
hFc
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 25; Apo-3; LARD; TNFRSF25; DR3; TNFRSF12; WSL; WSL1
AA Sequence

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMF

Molecular Weight

50-55 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DR3/TNFRSF25 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DR3/TNFRSF25 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72666
Quantity:
MCE Japan Authorized Agent: