1. Recombinant Proteins
  2. Others
  3. DPYSL2 Protein, Human (P.pastoris, His)

DPYSL2 protein plays a crucial role in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. It is essential for signaling by class 3 semaphorins and cytoskeleton remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. It interacts with CYFIP1/SRA1, HTR4, CLN6, and MICALL1, highlighting its diverse functions and interactions in cellular processes. DPYSL2 Protein, Human (P.pastoris, His) is the recombinant human-derived DPYSL2 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE DPYSL2 Protein, Human (P.pastoris, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DPYSL2 protein plays a crucial role in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. It is essential for signaling by class 3 semaphorins and cytoskeleton remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. It interacts with CYFIP1/SRA1, HTR4, CLN6, and MICALL1, highlighting its diverse functions and interactions in cellular processes. DPYSL2 Protein, Human (P.pastoris, His) is the recombinant human-derived DPYSL2 protein, expressed by P. pastoris , with N-His labeled tag.

Background

DPYSL2 protein is actively involved in neuronal development, polarity, axon growth, guidance, growth cone collapse, and cell migration. Its crucial role extends to signaling by class 3 semaphorins and subsequent cytoskeletal remodeling. DPYSL2 forms homotetramers and heterotetramers with CRMP1, DPYSL3, DPYSL4, or DPYSL5. The interaction with CYFIP1/SRA1 occurs through its C-terminus, and DPYSL2 also interacts with HTR4, CLN6, and MICALL1. These protein interactions highlight DPYSL2's multifaceted involvement in various cellular processes critical for neuronal function and development.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

Q16555 (M1-G572)

Gene ID
Molecular Construction
N-term
His
DPYSL2 (1M-572G)
Accession # Q16555
C-term
Protein Length

Full Length

Synonyms
Collapsin response mediator protein 2; Collapsin response mediator protein hCRMP 2; CRAM; CRMP 2; CRMP-2; N2A3; TOAD 64; TOAD64; ULIP 2 protein; ULIP-2; Ulip2
AA Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Predicted Molecular Mass
64 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DPYSL2 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DPYSL2 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71816
Quantity:
MCE Japan Authorized Agent: